SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028137 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028137
Domain Number 1 Region: 237-572
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.28e-110
Family PDEase 0.00000186
Further Details:      
 
Domain Number 2 Region: 1-77
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000324
Family Heme-binding PAS domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028137   Gene: ENSMMUG00000019838   Transcript: ENSMMUT00000030065
Sequence length 582
Comment pep:known chromosome:MMUL_1:7:64128682:64283261:-1 gene:ENSMMUG00000019838 transcript:ENSMMUT00000030065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGYQSGELIGKELGEVPINEKKADLLDTINSCIRIGKEWQGIYYAKKKNGDNIQQNVKII
PVIGQGGKIRHYVSIIRVCNGNNKAEKIPECVQSDTHTDNQTGKHKDRRKGSLDVKAVAS
RTTEVSSQRRHSSMARIHSMTIEAPITKVINIINAAQESSPMPVTEALDRVLEILRTTEL
YSPQFGAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTKNTQTVSSNIITPISLDDVPPR
IARAMENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRSWLQIIEA
NYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDHPGRTNSF
LCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQGIIDMVLA
TEMTKHFEHVNKFVNSINKPLATLEENGETDKNQEMINTMLRTPENRTLIKRMLIKCADV
SNPCRPLQYCIEWAARISEEYFSQTDEEKQQDLPVVMPVFDRNTCSIPKSQISFIDYFIT
DMFDAWDAFVDLPDLMQHLDNNFKYWKGLDEMKLRSLRPPPE
Download sequence
Identical sequences ENSMMUP00000026091 ENSMMUP00000028137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]