SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028140 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028140
Domain Number 1 Region: 279-609
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.24e-106
Family PDEase 0.00000126
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000028140
Domain Number - Region: 75-112
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00377
Family Flavin-binding PAS domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028140   Gene: ENSMMUG00000021358   Transcript: ENSMMUT00000030068
Sequence length 621
Comment pep:known_by_projection chromosome:MMUL_1:6:73567317:73664780:1 gene:ENSMMUG00000021358 transcript:ENSMMUT00000030068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDDHEEASVLPLLHAGFNRRFMENSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDH
CHEAIEITSDDHVIQEWQGVYYARRKSGDSIQQHVKITPVIGQGGKIRHFVSLKKLCCTT
DNNKQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDVKSISSRGSDAPSLQNRRYPSMARI
HSMTIEAPITKVINIINAAQENSPVTVAEALDRVLEILRTTELYSPQLGTKDEDPHTSDL
VGGLMTDGLRRLSGNEYVFTKNVHQSHSHLAMPITINDVPPCISQLLDNEESWDFNIFEL
EAVTHKRPLVYLGLKVFSRFGVCEFLNCSETTLRAWFQVIEANYHSSNAYHNSTHAADVL
HATAFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVL
ESHHTALAFQLTVKDTKCNIFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFVNSIN
KPMAAEIEGSDCECNPAGKNFPENQILIKRMMIKCADVANPCRPLDLCIEWAGRISEEYF
AQTDEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFAHLPALMQHLADN
YKHWKTLDDLKCKSLRLPSDS
Download sequence
Identical sequences ENSMMUP00000028140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]