SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028149 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028149
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-26
Family Kringle modules 0.00084
Further Details:      
 
Domain Number 2 Region: 184-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-25
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028149   Gene: ENSMMUG00000021370   Transcript: ENSMMUT00000030079
Sequence length 443
Comment pep:known chromosome:MMUL_1:10:72923837:72971351:1 gene:ENSMMUG00000021370 transcript:ENSMMUT00000030079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGD
VSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTCISF
CRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTL
VGACGGNYSAMSSVVYSPDFPDTYATGRVCYWTIRVPGASRIHFSFPLFDIRDSADMVEL
LDGYTHRVLARFHGRNRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEELPQERP
AVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVEG
WTVYGLATLLILTVTAIVAKILLHVTFKSHRVPASGDLRDCHQPGTSGEIWSIFYKPSTS
ISIFKKKLKGQSQQDDRNPLVSD
Download sequence
Identical sequences ENSMMUP00000028149 9544.ENSMMUP00000028149 ENSMMUP00000028149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]