SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028154 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028154
Domain Number 1 Region: 350-479
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.71e-24
Family Canonical RBD 0.00000417
Further Details:      
 
Domain Number 2 Region: 511-550
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000000000589
Family Ran binding protein zinc finger-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028154   Gene: ENSMMUG00000021374   Transcript: ENSMMUT00000030084
Sequence length 656
Comment pep:known chromosome:MMUL_1:10:73094862:73127708:1 gene:ENSMMUG00000021374 transcript:ENSMMUT00000030084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTAT
YGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGT
QPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYP
MQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSY
PPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNR
GRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDN
SAIYVQGLNDNVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDP
PTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGMPPREGRGMPPPLRGGPGGPGGP
GGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTEC
NQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFR
GGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY
Download sequence
Identical sequences A0A096NJD3 A0A2K5MV82 A0A2K5S4E0 A0A2K5WSC3 A0A2K5XKM9 A0A2K6CRQ9 A0A2K6QXH1 A0A2K6U5J5 F6VHH9
ENSMMUP00000028154 ENSCJAP00000037267 ENSMMUP00000028155 XP_005567744.1.63531 XP_007973494.1.81039 XP_010347480.1.74449 XP_010357589.1.97406 XP_011749013.1.29376 XP_011851114.1.47321 XP_011893119.1.92194 XP_015005477.1.72884 XP_017354967.1.71028 9544.ENSMMUP00000028154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]