SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028157 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028157
Domain Number 1 Region: 257-387
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.26e-24
Family Canonical RBD 0.00000417
Further Details:      
 
Domain Number 2 Region: 438-477
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000000051
Family Ran binding protein zinc finger-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028157   Gene: ENSMMUG00000021374   Transcript: ENSMMUT00000030087
Sequence length 583
Comment pep:known chromosome:MMUL_1:10:73094903:73127699:1 gene:ENSMMUG00000021374 transcript:ENSMMUT00000030087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTAT
YGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGT
QPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYP
MQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSY
PPQTGSYSQAPSQYSQQSSSYGQQRPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDNVT
LDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGK
DFQGSKLKVSLARKKPPMNSMRGGMPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGD
RGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLP
PPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGG
RRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY
Download sequence
Identical sequences ENSMMUP00000028157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]