SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028173 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000028173
Domain Number - Region: 123-173
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00719
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028173   Gene: ENSMMUG00000021386   Transcript: ENSMMUT00000030103
Sequence length 250
Comment pep:known chromosome:MMUL_1:1:128639034:128642623:-1 gene:ENSMMUG00000021386 transcript:ENSMMUT00000030103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT
DRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD
ACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSCVRTDYLD
Download sequence
Identical sequences ENSMMUP00000028173 9544.ENSMMUP00000028173 ENSMMUP00000028175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]