SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028175 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000028175
Domain Number - Region: 65-116
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0034
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028175   Gene: ENSMMUG00000021386   Transcript: ENSMMUT00000030105
Sequence length 190
Comment pep:known chromosome:MMUL_1:1:128639034:128642607:-1 gene:ENSMMUG00000021386 transcript:ENSMMUT00000030105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGKADEGLASLSEDGRSPISIRQM
AYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVV
FFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLR
SIQRSLLCKD
Download sequence
Identical sequences B4DUG7
ENSMMUP00000028175 NP_001230700.1.87134 NP_001230700.1.92137 XP_009243123.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]