SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028298 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028298
Domain Number 1 Region: 102-508
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.74e-88
Family L-arabinose binding protein-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028298   Gene: ENSMMUG00000021483   Transcript: ENSMMUT00000030240
Sequence length 893
Comment pep:known chromosome:MMUL_1:4:29337582:29369271:-1 gene:ENSMMUG00000021483 transcript:ENSMMUT00000030240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLLLLAPLFLRPPGAGGAQTPNATSECILLRRPRALLRPTSLSLHLLISGPHHDPVT
RGSVPVVGPKVRKCLANGSWTDMDTPSRCGSRASSLHKRRAVYIGALFPMSGGWPGGQAC
QPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSS
VSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKK
IATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYE
TEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIV
MLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGG
GRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYK
KIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVV
CLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRNQFPFVCQARLW
LLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIW
QIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLA
YETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYIT
LVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEER
VSELRHQLQSRQQLRSRRHPPTPPDPSGGLPRGPPEPPDRLSCDGSRVHLLYK
Download sequence
Identical sequences ENSMMUP00000028298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]