SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028320 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028320
Domain Number 1 Region: 1180-1320
Classification Level Classification E-value
Superfamily PRC-barrel domain 3.53e-60
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028320   Gene: ENSMMUG00000021497   Transcript: ENSMMUT00000030262
Sequence length 1325
Comment pep:known_by_projection chromosome:MMUL_1:15:2445273:2520374:1 gene:ENSMMUG00000021497 transcript:ENSMMUT00000030262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSLYNIRLLREFSNEYLNKCFYLTLEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFV
QPRDVQELKDVKTVLHQKSSRPPVPISNATKRSFLGSPAAGTPADLQPPAQLPADGCHRH
YLHPEEPEYLGKGTAAFSPSHPLLPLRQKQQKSIQGEDIPDQRHRSNSLTRVDGQPRGAA
IAWPEKKTRPASQPTPFALHHAASCEVDPSSGDSISLARSISKDSLASNIVNLTPQNQPH
PTAVKTHGKSLLNNVSIEDEEEELVAIVRADVAPQQADLEFPRASPRASGLIASARSPQG
QLDTSESKPDSFFLEPLMPAVLKPAKEKQVITKEDERGEGRPRSITSRRPSEGAQPLVRR
KVTGSRDLNRTFTPIPCSEFPMGIDPTETGPQSVETMGEVCGGPLALGGFDPFPQGPSTD
GFFLHVDRADEDTEGRLYVSCSKSPNSHDSEPWTLLRQDSDSDVVDIEEAEHDFLGEAHP
VVLSRYIGEEESAKLQEDMKVKEHEDKDDASGRSSPCLSTASQMSSVSVASGSVKMTSFA
ERKLQRLNSCETKSSTSSSQKTTPDASESCPAPLTTWRQKREQSPGRHGRDPASLLASEL
VQLHMQLEEKRRAIEAQKKKMEALSARQRLKLGKAAFLHVVKKGKAEAALSLRPEHFSKE
YSQHNGEDCGDGVSKTEDFLVKEEQREELLHEPQDVDKESLAFAQQHTAKDPVALHELER
NKVISAALLEDTVGEVVDVNECDLSIEKLNETISALQQAILKISQQQEQLLLKSPTVPVP
GSKSNSQDHKGKAPVHFVEPLSPTGVAGHRKAPRLGQGRNSRSGRPAELKVPKDRPQGSS
RSKTPTPSVETLPHLRPFPASSHPRTPTDPGLDGALEPSGDPHGKCLFDSYRLHDESNQR
TLTLSSSKDTNILSEQMSLKEVLDASVKEAGPSSSDVSGKESIPVEEPLRSRASLIEVDL
SDLKAPDEDGELASLDGSADLISEGDQKPGVGFFFKDEQKAEDELAKKRAAFLLKQQRKA
EEARVRKQQLEAEVELKRDEARRKAEEDRVRKEEEKARRELIKQEYLRRKQQQILEEQGL
GKPKSKPKKPRPKSVHREESCSDSGTKCSSTPDNLSRTQSGSSLSLASAATTEPESIHSG
GTPSQRVESMEALPILSRNPSRSTDRDWETASAASSLASVAEYTGPKLFKEPSSKSNKPI
IHNAISHCCLAGKVNEPHKNSILEATLEKCDANHYIILFRDAGCQFRALYCYYPDTEEIY
KLTGTGPKNITKKMIDKLYKYSSDRKQFNLIPAKTMSVSVDALTIHNHLWQPKRPAVPKK
GQTRK
Download sequence
Identical sequences ENSMMUP00000028319 9544.ENSMMUP00000028320 ENSMMUP00000028320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]