SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028363 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028363
Domain Number 1 Region: 807-935,980-1153
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.66e-79
Family Protein kinases, catalytic subunit 0.00000000172
Further Details:      
 
Domain Number 2 Region: 660-750
Classification Level Classification E-value
Superfamily Immunoglobulin 2.75e-22
Family I set domains 0.0067
Further Details:      
 
Domain Number 3 Region: 124-222
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000125
Family I set domains 0.0000129
Further Details:      
 
Domain Number 4 Region: 568-642
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000778
Family V set domains (antibody variable domain-like) 0.032
Further Details:      
 
Domain Number 5 Region: 350-431
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000115
Family I set domains 0.038
Further Details:      
 
Domain Number 6 Region: 235-331
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000346
Family I set domains 0.029
Further Details:      
 
Domain Number 7 Region: 419-468,506-554
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000375
Family I set domains 0.046
Further Details:      
 
Domain Number 8 Region: 33-109
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000071
Family V set domains (antibody variable domain-like) 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028363   Gene: ENSMMUG00000021538   Transcript: ENSMMUT00000030310
Sequence length 1338
Comment pep:known chromosome:MMUL_1:17:7947475:8136681:-1 gene:ENSMMUG00000021538 transcript:ENSMMUT00000030310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFCWDTGVLLCALLGCLLLTGSSSGSKLKGPELSLKGTQHVTQAGQTLHLQCRGEAAHQ
WSLPETVSKESKRLSITKSACGRNGKQFCSTLTLNAAQANHTGFYSCKYLAVPTSKKKET
ESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELIIPCRVTSPNITVTLKKFPLDTLIPD
GKRVIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPV
KLLRGHTLILNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
VQNKDKGLYTCRVRSGPSFKYVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVK
AFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTA
TLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPRPTIKWCWRPCNHNHSEARY
DFCSNNEESFILDPDSNIGNRIESITQRMAIIEGKNKTASTLVVADSRISGIYSCIASNK
VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM
HYSISKQKMAITKEHSITLNLTIMNVSLEDSGTYACRARNVYTGEEILQKKEVTIRDQEA
PYLLRNLSDHTVAISSSTTLDCHANGAPEPQITWFKNNHKIQQEPGIILGPGSSTLFIER
VTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFI
RKMKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGK
VVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTK
QGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSV
TSSESFASSGFQEDKSLSDVEEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIH
RDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYSTKS
DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRD
PKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKEGISA
PKFNSESSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTW
TDSKPKASLKIDLRVTSKSKESGLSDASRPSFCHSSCGHISEGKRRFTYDNAELERKIAC
CSPPPDYNSVVLYSTPPV
Download sequence
Identical sequences F7FAY2
XP_001117928.2.72884 9544.ENSMMUP00000028363 ENSMMUP00000028363 ENSMMUP00000028363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]