SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028385 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028385
Domain Number 1 Region: 6-185
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.23e-50
Family Eukaryotic proteases 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028385   Gene: ENSMMUG00000021555   Transcript: ENSMMUT00000030332
Sequence length 205
Comment pep:known_by_projection chromosome:MMUL_1:19:432277:436291:-1 gene:ENSMMUG00000021555 transcript:ENSMMUT00000030332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDLRTGLVVLGAHALRTAEPTQQVFGISAITNHPDFHPVTHVNDICLLRLNSSAVLGPAV
GLLRLPGRRARPPTAGTRCRVAGWGFVSDFEDLPPGLMEAEVRVLDLDVCNSSWKGHLSH
TMLCTRSGDRHRRGFCSADSGGPLVCRNRAHGLVSFSGLWCGDPKTPDVYTRVSSFVAWI
WDVVRRSSPQPRPLRGTTRPPGGVA
Download sequence
Identical sequences ENSMMUP00000028385 9544.ENSMMUP00000028385 ENSMMUP00000028385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]