SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028390 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028390
Domain Number 1 Region: 401-512
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-22
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 582-689
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-21
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 3 Region: 695-760
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 754-816
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000124
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 5 Region: 821-881
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000181
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 6 Region: 339-397
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000361
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 517-581
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000222
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 8 Region: 225-277
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000034
Family Spermadhesin, CUB domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028390   Gene: ENSMMUG00000021557   Transcript: ENSMMUT00000030337
Sequence length 979
Comment pep:known_by_projection chromosome:MMUL_1:16:24172992:24199423:-1 gene:ENSMMUG00000021557 transcript:ENSMMUT00000030337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLSSEAPTMGKGQAPGIEETDGELTAAPTPEQPERGVHFVTTAPTLKLLNHHPLLEEFLQ
EGLEKGDEELRPALPFQPDPPTPFTPSPLPRLANQDSRPVFTSPTPATAAVPTQPQSKEG
PWSLESEPPVLRITAPLPPGPSMAVPTLGPGDRPSTTPPSRAWTPTQEGPGDMGRPWVPE
VVSQGAGIGIPGTIASSTASGDDEETTTTTTTTIITTTITTVQTPGPCSWNFSGPEGSLD
SPTDLSSPPDVGLDCFFYISVYPGYGVEIKVSDLDLARAKLGLLGLGGPSPTPVGPLPFF
LQPHQLQVPTLDAHPLTQTLYPPEDEFSSHFHRYTYLLSCHFPHRPAYGDVTVTSLHPGG
SARFHCATGYQLKGARHLTCLNATQPFWDSKEPVCIGESACGGVIRNATTGRIVSPGFPG
NYSNNLTCHWLLEAPEGQRLHLHFEKVSLAEDDDRLIIRNGDNVEAPPVYDSYEVEYLPI
EGLLSSGKHFFVELSTDSSGAAAGMALRYEAFQQGHCYEPFVKYGNFSSSAPTYPVGTTV
EFSCDPGYTLEQGSIIIECVDPHDPQWNETEPACRAVCSGEITDSAGVVLSPNWPEPYGR
GQDCIWGVHVEEDKRIMLDVRVLRIGPGDVLTFYDGDDLTARVLGQYSGPHSHFKLFTSM
ADVTIQFQSDPGTSVLGYQQGFVIHFFEVPRNDTCPELPEIPNGWKSPSQPDLVHGTVVT
YQCYPGYQVVGSSVLMCQWDLTWSEDLPSCQRVTSCHDPGDVEHSRRLISSPKFPVGATV
QYICDQGFVLTGTSILTCHDRQAGSPKWSDRAPKCLLEQLKPCHGLSAPENGARSPEKRL
HPAGATIHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICKAASLDGFYNSRSLDVAKAP
AASSTLDAAHIAAAIFLPLVAMVLLVGGVYFYFSRLQGKSSLQLPRTRPRPYNRITVESA
FDNPTYETGSLSFAGDERI
Download sequence
Identical sequences ENSMMUP00000028390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]