SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028481 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028481
Domain Number 1 Region: 121-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000117
Family Cripto EGF-like domain-like 0.0049
Further Details:      
 
Domain Number 2 Region: 89-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000194
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028481   Gene: ENSMMUG00000021625   Transcript: ENSMMUT00000030435
Sequence length 227
Comment pep:known chromosome:MMUL_1:13:137524581:137531026:1 gene:ENSMMUG00000021625 transcript:ENSMMUT00000030435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWRHHARFLFTVSLALQIINLGNSYQREKHNGRREEVTKVATQKHQQSPLNWTSSHSGE
VTGSAQGWGPEEPLPYSRAFGEGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRR
SECGALEHGAWTLRGCHLCRCVFGTLHCLPLQTPGSCDPKDFLASHAPGRGAGGAPSLLL
LLPCALLHHLLRPDAPAHPRSLVPSVLQRERPCGRPGPGHRLSFSLL
Download sequence
Identical sequences ENSMMUP00000028481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]