SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028507 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028507
Domain Number 1 Region: 311-485
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.42e-25
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 651-757
Classification Level Classification E-value
Superfamily POZ domain 3.77e-23
Family BTB/POZ domain 0.0037
Further Details:      
 
Domain Number 3 Region: 8-114
Classification Level Classification E-value
Superfamily Histone-fold 4.19e-21
Family Nucleosome core histones 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028507   Gene: ENSMMUG00000021647   Transcript: ENSMMUT00000030464
Sequence length 839
Comment pep:known_by_projection chromosome:MMUL_1:14:37462995:37669308:1 gene:ENSMMUG00000021647 transcript:ENSMMUT00000030464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGDGLRRGKSARCGLTFSVGRFFRWMVDTRISVRIHEYAAISLTACMENLVEEIRARV
MASQSPDGGGAGGGEVSAEALEMVINNDAELWGPSLPYRMMRCGPFKNGVLSLPAYFSPY
NGGSLGHDERADAYAQLELRTLEQSLLATCVGSISELSDLVSRAMHHMQGRHPLCPGASP
ARQARQPPQPITWSPDALHTLYYFLRCPQMESMENPNLDPPRMTLNNERPFMLLPPLMEW
MRVAITYAEHRRSLTVDSGDIRQAARLLLPGLDCEPRQLKPEHCFSSFRRLDARAATEKF
NQDLGFRMLNCGRTDLINQAIEALGPDGVNTMDDQGMTPLMYACAAGDEAMVQMLIDAGA
NLDIQVPSNSPRHPSIHPDSRHWTSLTFAVLHGHISVVQLLLDAGAHVEGSAVNGGEDSY
AETPLQLASAAGNYELVSLLLSRGADPLLSMLEAHGMGSSLHEDMNCFSHSAAHGHRNVL
RKLLTQPQQAKADVLSLEEILAEGVEESDASSQGSGSEGPVRLSRTRTKALQEAMYYSAE
HGYVDITMELRALGVPWKLHIWIESLRTSFSQSRYSVVQSLLRDFSSIKEEEYNEELVTE
GLQLMFDILKTSKNDSVIQQLAAIFTHCYGSSPIPSIPEVRKTLPARLDPHFLNNKEMSD
VTFLVEGKLFYAHKVLLVTASNRFKTLMTNKSEQDGDSSKTIEISDMKYHIFQMMMQYLY
YGGTESMEIPTADILELLSAASLFQLDALQRHCEILCSQTLSVESAVNTYKYAKIHNAPE
LALFCEGFFLKHMKALLEQDAFRQLIYGRSSKVQGLDPLQDLQNTLAERVHSVYITSRV
Download sequence
Identical sequences ENSMMUP00000028507 9544.ENSMMUP00000028507 ENSMMUP00000028507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]