SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028617 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028617
Domain Number 1 Region: 41-537
Classification Level Classification E-value
Superfamily Sema domain 2.22e-181
Family Sema domain 0.0000000000167
Further Details:      
 
Domain Number 2 Region: 533-585
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000209
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 601-683
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000047
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028617   Gene: ENSMMUG00000021730   Transcript: ENSMMUT00000030577
Sequence length 777
Comment pep:known chromosome:MMUL_1:3:132145159:132272744:1 gene:ENSMMUG00000021730 transcript:ENSMMUT00000030577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNANKDERLKARSQDFHLFPALMMLSMAMLFLPVIGTSKQNIPRLKLTYKDLLLSNSCIP
FLGSSEGLDFQTLLLDEERGRLLLGAKDHIFLLSLVDLNKNFKKIYWPAAKERVELCKLA
GKDANTECANFIRVLQPYNKTHIYVCGTGAFHPICGYIDLGVYKEDVIFKLDTHNLESGR
LKCPFDPQQPFASVMTDEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNG
AKFIGTFPIPDTYNPDDDKIYFFFRESSQEGSTSDKTILSRVGRVFKNDVGGQRSLINKW
TTFLKARLICSIPGSDGADTYFDELQDIYLLPTRDERNPVVYGVFTTTSSIFKGSAVCVY
SMADIRAVFNGPYAHKESADHRWVQYDGRIPYPRPGTCPSKTYDPLIKSTRDFPDDVISF
IKRHSVMYKSIYPVAGGPTFKRINVDYRLTQIVVDHVTAEDGQYDVMFLGTDIGTVLKVV
SISKEKWNMEEVVLEELQIFKHSSIILNMELSLKQQQLYIGSRDGLVQLSLHRCDTYGKA
CADCCLARDPYCAWDGNACSRYAPTSKRRARRQDVKYGDPITQCWDIEDSISHETADEKV
IFGIEFNSTFLECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
GIYYCKAQEHTFIHTIVKLTLNVIENEQMENTQRAEHEEGQVKDLLAESRLRYKDYIQIL
SSPNFSLDQYCEQMWHREKRRQRNKGGPKWKHMQEMKKKRNRRHHRDLDELPRAVAT
Download sequence
Identical sequences ENSMMUP00000028617 9544.ENSMMUP00000028617 ENSMMUP00000028617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]