SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028626 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028626
Domain Number 1 Region: 3-41
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000255
Family LEM domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028626   Gene: ENSMMUG00000021734   Transcript: ENSMMUT00000030586
Sequence length 509
Comment pep:known chromosome:MMUL_1:4:33480446:33499296:-1 gene:ENSMMUG00000021734 transcript:ENSMMUT00000030586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLSDLELRRELQALGFQPGPITDTTRDVYRNKLRRLRGEARLRDEERLREEARPREEA
QPRGEERLREEARLREDAPLRARPAAGSPRAEPWLSQPASGSAYATPGAYGDIRPSAASW
VGSRGLAYPARPAQLRRRASVRGSSEEDEDARTPDRATQGPGLAARRWWAASPAPARLPS
ALLGPDPRPGLRATRAGPAGAARARPEVGRRLERWLSRLLLWASLGLLLVFLGILWVKMG
KPSAPQEAEDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPEN
LKSKCIPVMEAQEYIANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDQSELVTTVDKVV
CLESARPRMGVGCRLSRALLTAVTNVLIFFWCLAFLWGLLILLKYRWRKLEEEEQAMYEM
VKKIIDVVQDHYVDWEQDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESR
IQTESHRVAGEDMLVWRWTKPSSFSDSER
Download sequence
Identical sequences XP_001116367.1.72884 XP_005553336.2.63531 ENSMMUP00000028626 9544.ENSMMUP00000028626 ENSMMUP00000028624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]