SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028679 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028679
Domain Number 1 Region: 766-1013
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.83e-78
Family Eukaryotic proteases 0.0000701
Further Details:      
 
Domain Number 2 Region: 432-553
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.79e-36
Family Frizzled cysteine-rich domain 0.00016
Further Details:      
 
Domain Number 3 Region: 116-228
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.09e-30
Family Frizzled cysteine-rich domain 0.0007
Further Details:      
 
Domain Number 4 Region: 633-677
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 557-595
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 321-359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 285-321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 248-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 358-393
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 10 Region: 599-631
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000105
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 11 Region: 690-769
Classification Level Classification E-value
Superfamily SRCR-like 0.0000915
Family Scavenger receptor cysteine-rich (SRCR) domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028679   Gene: ENSMMUG00000021779   Transcript: ENSMMUT00000030643
Sequence length 1021
Comment pep:known_by_projection chromosome:MMUL_1:5:42830153:43043172:-1 gene:ENSMMUG00000021779 transcript:ENSMMUT00000030643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLRADDNNMGNGCSQKLATANPLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNG
SEPLVTDGEIQESDVILTNTIYNQSTVISTAHPDQHIPAWTTDASLPGDQSHRNTSACMN
ITHSQCQMLPYHSTPTPLLSVVRNMEMEKFLKFFTYLHRLSCYQHIMLFGCSLAFPECII
DGDDSHGLLPCRSFCEAAKEGCESVLGMVNYSWPDFLKCSQFRNHTESSDVSRICFSPQQ
ENGKQLLCGGGESFLCASGICIPRKLQCNGYNDCDDWSDEAHCNCSENLFHCHTGKCLNY
SLVCDGYDDCGDLSDEQNCDCNPTTEHRCGDGRCIAMEWVCDGDHDCVDKSDEVNCSCHS
QGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSGSQTPCQEGDRRCLYIACIDSCGGSS
LCDPNNSLNNCSQCEPITLELCMNLPYNSTSYPNYLGHRTQKEASISWESSLFPALVQTN
CYKYLMFFACTILVPKCDVNTGQSIPPCRALCEHSKERCESVLGIVGLQWPEDTDCSQFP
EENSDNQTCLMPDEYVEECSPSHFKCRSGRCVLASRRCDGQADCDDDSDEENCGCKERDL
WECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRNLWCDGEADCS
DSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADGWQEMFSQLACKQMGLGEPSVTELI
QEQEKELRWLTLHSNWESLNGTTLHELLVNGQSCQSRSKISLLCTKQDCGRRPAARMNKR
ILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGIN
NLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIIELNEDISETGYVRPVCLPSPEQWLE
PDTYCYITGWGHMGNKMPFKLQEGEVRIISLEQCQSYFDMKTITTRMICAGYESGTVDSC
MGDSGGPLVCEKPGGQWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVEWIKRQIYIQTFLL
N
Download sequence
Identical sequences 9544.ENSMMUP00000028679 ENSMMUP00000028679 ENSMMUP00000028679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]