SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028711 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028711
Domain Number 1 Region: 360-461
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.91e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000028711
Domain Number - Region: 226-267
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0838
Family BphP N-terminal domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028711   Gene: ENSMMUG00000021798   Transcript: ENSMMUT00000030676
Sequence length 1292
Comment pep:known_by_projection chromosome:MMUL_1:16:7900534:7912312:-1 gene:ENSMMUG00000021798 transcript:ENSMMUT00000030676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGPLEGADGGGDPRPGESFCPGGVPSPGPPQHRPCPGPSLADDTDANSNGSSGNESNGH
ESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPS
TSGCSSEQSARARTQKELMTALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQANQE
YYQQWSLEEGEPCSMDMSTYTLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQAAV
LLRCKRDVFRGTRFSELLAPQDVGVFYGSTAPSRLPTWGTGASAGSGLRDFTQEKSVFCR
IRGGPDRDPGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDKRIF
TTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAGQPF
DHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPAP
TLDTDIQELSEQIHRLLLQPVHSPSPTGLCGVGPVTSPGPLHSPGSSSDSNGGDAEGPGP
PAPVTFQQICKDVHLVKHQGQQLFIESRARPQPRPRLPATGTFKARALPCQSPDPELETG
SAPIPAPLALAPEEAERKEASSCSYQQINCLDSILRYLESCNLPSTTKRKCASSSSYTTS
SASDDDKQRTGPVPVGTKKDPPSAVLSGEGATPRKEPVVGGTLSPLALANKAESVVSVTS
QCSFSSTIVHVGDKKPPESDIIMMEDLPGLAPGPAPSPAPSPTVAPDPAPDAYRPVGLTK
AVLSLHTQKEEQAFLSRFRDLGRLRGLDSSSTAPSALGERGCHHGPAPLSRRHHCRSKAK
RSRHHQSPRAEAPCYVSHPSPVPPSTPWPAPPATTPFPAVVQPYPLPVFSPRGGPQPLPP
APTSVPPAAFPTPLVTPMVALVLPNYLFPTPSSYPYGAPQTPAEGPPTPASYSPSPSLPA
LPPSPPRRPDSPLFNSRCSSPLQLNLLQLEELPRAEGAAGAGGPGSSAGPPPPSEEAAEP
EARLVEVTESSNQVSLSGSSDLLELLLQDESRSGTGSAASGSLGSGLGSGSGSGSHEGGS
TSASITRDSQSSHTSKYFGSIDSSEAEAGAARGGAEPGDQVIKYVLQDPIWLLMANADQR
VMMTYQVPSRDMTSVLKQDRERLRAMQRQQPRFSEDQRRELGAVHSWVRKGQLPRALDVM
ACVDCGSSTQDPGHPDDPLFSELDGLGLEPMEEGGGEQGSSGGGSGEGEGCEEARAQGGA
KASSSQDLAMEEEKESRSSASPALPTAGNGTS
Download sequence
Identical sequences ENSMMUP00000028711 9544.ENSMMUP00000028711 ENSMMUP00000028711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]