SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028778 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028778
Domain Number 1 Region: 9-125
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0000000562
Family Cgl1923-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028778   Gene: ENSMMUG00000021855   Transcript: ENSMMUT00000030750
Sequence length 264
Comment pep:novel chromosome:MMUL_1:18:2008633:2033082:-1 gene:ENSMMUG00000021855 transcript:ENSMMUT00000030750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNP
YATAEGNSTELSINAEGINFSIYKLYIILFSQWCAKYKSKPFCEKLLSWVKSSGCARVIV
LSSSHSYQRNDLQLRSTPFRYLLTPSMQRSVQNKIKSLNWQEMEKSRCIPEIDDSEFCIR
IPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQIIKPLSDDPTA
STSRWKIPSSWRLLFGSGLPPALF
Download sequence
Identical sequences 9544.ENSMMUP00000028778 ENSMMUP00000028778 ENSMMUP00000028778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]