SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028788 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028788
Domain Number 1 Region: 768-1027
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.13e-73
Family Eukaryotic proteases 0.000000398
Further Details:      
 
Domain Number 2 Region: 345-503
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-37
Family MAM domain 0.0083
Further Details:      
 
Domain Number 3 Region: 524-636
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-23
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 4 Region: 232-336
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-18
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 5 Region: 54-164
Classification Level Classification E-value
Superfamily SEA domain 7.45e-17
Family SEA domain 0.0052
Further Details:      
 
Domain Number 6 Region: 684-777
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000575
Family Scavenger receptor cysteine-rich (SRCR) domain 0.012
Further Details:      
 
Domain Number 7 Region: 643-680
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000772
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 183-222
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028788   Gene: ENSMMUG00000021860   Transcript: ENSMMUT00000030760
Sequence length 1028
Comment pep:known_by_projection chromosome:MMUL_1:3:28516729:28650868:1 gene:ENSMMUG00000021860 transcript:ENSMMUT00000030760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKRSVSSRHHSLSSYEIMFATLFAILVVLCAGLIAVSWLTIKESQRGAALGQSHEVRG
TFKITSGVTYNPNLQDKLSADFKVLAFDLQQMIDEIFLSSNLKNEYKNSRVLQFENGSII
VTFELFFAQWVSDENVKEELIQGVEANKSSQLVTFHIDLNSVDILGKLTTTSHLATPGRN
VSVECPPGSSPCADTLTCIKADLFCDGEVNCPDGSDEDNKMCATVCDGRFLLTGSSGSFQ
ATHYPKPSESSVVCQWIIRVNQGLSIKLSFDHFNIYYTDTLNIYEGVGSSKILRASIWET
NPGTIRIFSNQVTATFLIESDESDYVGFNVTYTAFNSSELNNYEKINCNFEDGFCFWVQD
LNDDNEWERIQGSTFPPFTGPNFDHTFGNASGFYISTPTGPGGRKEHVGLLSLHLDPTLE
PACLSFWYHMYGENVHKLSINISNDQNMEKTVFQKEGNYGENWNYGQVTLNETVKFKVGF
HAFKNKILSDIALDDISLTHGICNGSLYPEPTLVPTPPPELPTDCGGPFELWEPNTTFSS
MNFPNSYPNLAFCVWILNAQKGKNIQLHFQEFDLENINDVVEIRDGGEADSLFLRTAVYT
GPGPVKDVFSTTSRMTVLLITNDVLARGGFKANFTTGYHLGIPEPCMEDNFQCKNGECVP
LANLCDGHLHCEDGSDEADCERDINGTTNNNGLVQFRIQSLWHTACAENWTTHISNDVCQ
LLGLGSGNSSMPIFSTNGGPFVKLNTAPDGSLILTPSQQCLQDSLIRLRCNHKSCGKKLV
AQDITPKIVGGSNAEEGAWPWVVGLYYGGRLLCGASLVSSDWLVSAAHCVYGQHPEPLRF
MSLLEVVSTSNLVFPYTWPFINNSFLLTRHHWLYEYNRKYRKHIELAPLSIEHLLVFPDY
VQPICLPEENQVFPAGRNCSIAGWGTVVYQGSTANILQEADVPLLSNEKCQQQMPEYNIT
ENMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLAGVTSFGYKCALPNRPGVYARVPRFT
EWIQSFLH
Download sequence
Identical sequences ENSMMUP00000028788 ENSMMUP00000028788 9544.ENSMMUP00000028788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]