SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028802 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028802
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily POZ domain 7.85e-29
Family BTB/POZ domain 0.00084
Further Details:      
 
Domain Number 2 Region: 424-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 338-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.19e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 465-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.96e-18
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 5 Region: 303-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 386-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000135
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028802   Gene: ENSMMUG00000021875   Transcript: ENSMMUT00000030775
Sequence length 610
Comment pep:known chromosome:MMUL_1:2:117230150:117244280:-1 gene:ENSMMUG00000021875 transcript:ENSMMUT00000030775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYSHHCEHLLERLNKQREAGFLCDCTIVIGEFQFKAHRNVLASFSEYFGAIYRSTSENN
VFLDQSQVKADGFQKLLEFIYTGTLNLDSWNVKEIHQAADYLKVEEVVTKCKIKMEDFAF
IANPSSTEICSITGNVELNQQTCLLTLRDYNNREKSEVSTDSVQANPKQGALAKKSSQTK
KKKKPFNSPKTGQNKTVQYPSDILENASVELFLDANKLSTPVVEQVAQINDNSELELTSV
VENTFPAQDIVQTVTVKRKRGKSQPNCALKEHSMSNIASVKSPYEAENSGEELDQRYSKA
KPMCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTGEKPYKC
ELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRC
GQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITHSRKHTGEKPYICGICGKSF
ISSGELNKHFRSHTGERPFICELCGNSYTDIKNLKKHKTKVHSGADKTLDSSVEDHTLSE
QDSIQKSPLSETMDVKPSDMTLPLALPLGTEDHHMLLPVTDTQSPTSDTLLRSTVNGYSE
PQLIFLQQLY
Download sequence
Identical sequences A0A2K5NH27 A0A2K5YM74 F6Q5I9
ENSMMUP00000028802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]