SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028807 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028807
Domain Number 1 Region: 325-419
Classification Level Classification E-value
Superfamily Immunoglobulin 6.52e-28
Family I set domains 0.00049
Further Details:      
 
Domain Number 2 Region: 121-220
Classification Level Classification E-value
Superfamily Immunoglobulin 1e-23
Family I set domains 0.0001
Further Details:      
 
Domain Number 3 Region: 26-119
Classification Level Classification E-value
Superfamily Immunoglobulin 8.26e-22
Family I set domains 0.0000791
Further Details:      
 
Domain Number 4 Region: 223-317
Classification Level Classification E-value
Superfamily Immunoglobulin 1.51e-21
Family I set domains 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028807   Gene: ENSMMUG00000021880   Transcript: ENSMMUT00000030780
Sequence length 464
Comment pep:known chromosome:MMUL_1:19:60351766:60435495:-1 gene:ENSMMUG00000021880 transcript:ENSMMUT00000030780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPILTLLICLGLSLDTRTHVQAGTLPKPTLWAEPGSVIIWGSPVTIWCRGTLEAQEYRL
DKEGSTEPWDTQKPLEPRNKARFSTPFMTERHAGRFRCYYLSHAGRSELSDPLELVVTGA
YSKPTLSALPSPVVASGGNVTLRCGSQQGYQHFVLIEEGEHRLPRTLDSQQLHSGWYQAL
FPVGPVTPSHRWTFRCYYYYRNTPQVWSHPSDPLELLASGVSRKPSLLTLQGPIVVPGEN
LTLQCGSDAGYDRFALYKERERDFLQRPGRQHQAGLSQANFTLSPMRGSHGGQYRCYGAH
NLSSEWSAPSDPLDILISRQFYDVVSLSVQPGPTVASGENVTLLCQSWAQFHTFLLTKEG
AAHPPLHLRSKHQAQQYQAEFPMGPVTSAHAGTYRCYSSLSSNPYLLSHPSDPLELVVSA
SHPQDYTVENLIRMGMAGLILVVLGILLFEALRSRRSPQEAAGR
Download sequence
Identical sequences ENSMMUP00000028807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]