SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028828 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028828
Domain Number 1 Region: 236-295
Classification Level Classification E-value
Superfamily C-type lectin-like 4.02e-18
Family C-type lectin domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028828   Gene: ENSMMUG00000021892   Transcript: ENSMMUT00000030803
Sequence length 303
Comment pep:known_by_projection chromosome:MMUL_1:19:14295617:14315021:1 gene:ENSMMUG00000021892 transcript:ENSMMUT00000030803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHNLYAVTGYPDPPEGTMEEEEEDDDYENSAPPYKDLPPKPDFLRREVQERNVGGKVPES
QKLVLEKLGVDCGLPISSPFHPKPRFYLDLDLKPKKSRGAMSPPKAQSCPHLHMQPRIHS
PIHLHHPLILPPALGERLKPHAHSPATPAPWLNQTSEGPGCCQKRCMMYLCLPVVISLIL
GCVGLTVTLIKYQELMEELRMLSFQQMTWRANMTGMSGLAGLKHDIDRVRADTNQSLVEL
RGLLGCRRVTCPEGWLPFEGKCYYFSPITKSWDEARIFCQENYSHLVIINSFAEHLLGAR
GTQ
Download sequence
Identical sequences ENSMMUP00000028828 9544.ENSMMUP00000028828 ENSMMUP00000028828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]