SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029009 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029009
Domain Number 1 Region: 23-50
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000994
Family Ran binding protein zinc finger-like 0.0032
Further Details:      
 
Domain Number 2 Region: 168-195
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000523
Family Ran binding protein zinc finger-like 0.004
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029009
Domain Number - Region: 104-130
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000112
Family Ran binding protein zinc finger-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029009   Gene: ENSMMUG00000022028   Transcript: ENSMMUT00000030993
Sequence length 727
Comment pep:known chromosome:MMUL_1:9:124541503:124584268:1 gene:ENSMMUG00000022028 transcript:ENSMMUT00000030993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYIIYSFLPDTAHFKKCTMSERGIKWACEYCTYENWPSAIKCTMCRAQRPSGTIITEDP
FKSGSSDVGRDWDPSSTEGGSSPLICPDSSARPRVKSSYSMENANKWSCHMCTYLNWPRA
IRCTQCLSQRRTRSPTESPQSSGSGSRPVAFSVDPCEEYNDRNKLNTRTQHWTCSVCTYE
NWAKAKRCVVCDHPRPNNIEAIELAETEEASSIINEQDRARWRGSCSSGNSQRRSPPATK
RDSEVKMDFQRIELAGAVGSKEELEVDFKKLKQIKNRMKKTDWLFLNACVGVVEGDLAAI
EAYKSSGGDIARQLTADEVRLLNRPSAFDVGYTLVHLAIRFQRQDMLAILLTEVSQQAAK
CIPAMVCPELTEQIRREIAASLHQRKGDFACYFLTDLVTFTLPADIEDLPPTVQEKLFDE
VLDRDVQKELEEESPIINWSLELATRLDSRLYALWNRTAGDCLLDSVLQATWGIYDKDSV
LRKALHDSLHDCSHWFYTRWKDWESWYSQSFGLHFSLREEQWQEDWAFILSLASQPGASL
EQTHIFVLAHILRRPIIVYGVKYYKSFRGETLGYTRFQGVYLPLLWEQSFCWKSPIALGY
TRGHFSALVAMENDGYGNRGAGANLNTDDDVTITFLPLVDSERKLLHVHFLSAQELGNEE
QQEKLLREWLDCCVTEGGVLVAMQKSSRRRNHPLVTQMVEKWLDRYRQIRPCTSLSDGEE
DEDDEDE
Download sequence
Identical sequences G7N1C8 G7PEB4
ENSMMUP00000029009 ENSMMUP00000029009 9544.ENSMMUP00000029009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]