SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029035 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029035
Domain Number 1 Region: 166-268
Classification Level Classification E-value
Superfamily SRCR-like 8.37e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029035   Gene: ENSMMUG00000022044   Transcript: ENSMMUT00000031019
Sequence length 270
Comment pep:known_by_projection chromosome:MMUL_1:8:28023307:28136792:-1 gene:ENSMMUG00000022044 transcript:ENSMMUT00000031019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENKAMYLHTVSDCDTSSICEDSFDGRSLSKLNLCEDGPCHKRRASSCCTQLGSLSALKH
AVLGLYLLVFLILVGIFILAGPPGPKGDQGDEGKEGRPGIPGLPGLRGLPGERGTPGLPG
PKGDDGKLGATGPMGMRGFKGERGPKGEKGEKGDRAGDASGVEAPMMIRLVNGSGPHEGR
VEVYHDRRWGTVCDDGWDKKDGDVVCRMLGFRGVEEVYRTARFGQGTGRIWMDDVACKGT
EETIFRCSFSKWGVTNCGHAEDASVTCNRH
Download sequence
Identical sequences A0A2K5LY28 A0A2K5UHT8 A0A2K6A3Q1 A0A2K6E1Q1 F7HRA3
ENSMMUP00000029035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]