SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029108 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029108
Domain Number 1 Region: 1031-1142
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-47
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000066
Further Details:      
 
Domain Number 2 Region: 1245-1348
Classification Level Classification E-value
Superfamily SRCR-like 7.72e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 474-579
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00024
Further Details:      
 
Domain Number 4 Region: 46-151
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00055
Further Details:      
 
Domain Number 5 Region: 153-258
Classification Level Classification E-value
Superfamily SRCR-like 1.28e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00053
Further Details:      
 
Domain Number 6 Region: 581-685
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00031
Further Details:      
 
Domain Number 7 Region: 259-364
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00075
Further Details:      
 
Domain Number 8 Region: 792-897
Classification Level Classification E-value
Superfamily SRCR-like 5.62e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.001
Further Details:      
 
Domain Number 9 Region: 367-471
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00054
Further Details:      
 
Domain Number 10 Region: 688-793
Classification Level Classification E-value
Superfamily SRCR-like 1.12e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0011
Further Details:      
 
Domain Number 11 Region: 897-1002
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 12 Region: 1140-1244
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-24
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029108   Gene: ENSMMUG00000022109   Transcript: ENSMMUT00000031099
Sequence length 1421
Comment pep:known_by_projection chromosome:MMUL_1:11:7650866:7732702:-1 gene:ENSMMUG00000022109 transcript:ENSMMUT00000031099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLPQNSWHIDFGRCCCHQNLFSAMVTCILLLNSCFLISSFNGTDLELRLVDGDGPCSGR
VEVKFQGQWGTVCDDGWNPAASIVVCKQLGCPFSFTMFHFGQAVTRYGKIWLDDVSCYGN
ESALWECQHREWGSHDCNHGEDVGVNCYGEANLGLRLVDGNSSCSGRVEVKFQERWGTIC
DDGWNSNTAAVVCRQLGCPSSFISSGVVDSPAVLGPIWLDDIICQGNELAIWNCRHRGWG
NHDCSHYEDVTLTCYDSSDLELRLVGGTNRCVGRVELKIQGRWGTICHHKWNNAAADVVC
KQLGCGTALHFAGLPHLQSGSDVVWLDGVSCSGNESFLWDCRHSATVNMDCIHQNDVSVI
CSDGADLELRLADGSDNCSGRVEVRIHEQWWTICDQNWKNEQALVVCKQLGCPFSVFGSR
RAKPSNEARDIWINSISCTGNESSLWDCIYDGKAKRTCFRRSDAGVICSDKADLDLRLAG
ADSPCYGRLEVKYQGQWGTVCHDRWSTRNAAVVCKRLGCGKPIRMFGITYFKEASGPIWL
DDVSCIGNESDIWDCKHNGWGKHNCVHREDVIVTCSGNATWGLRLAGGSNRCSGRLEVYF
QEQWGTVCDDGWNSIAAAVVCSQLDCPTSIIGMGLGNTSTGYGKIWLDDVSCDGDESDLW
SCRNSGWGNNDCSHGEDVGVICSDASDMELRLVGGSSRCAGRVEVKVQGASGILCANSWG
INIAEVVCRQLECGSPILVYREPHFTERTLHIFISNSGCTGREASLWDCIRWEWKQTACR
LNMEASVICSAHRQPRLVGADMPCSGRVEVKRADTWGSVCDSDFSLHAANVLCRELNCGD
AVSLSVGDHFGKGSGLTWAEKIQCEGSETHLALCPTVQHPEDTCIHSREVGVVCSRYTDV
RLVNGKSQCDGQVEIKVLGQWGLLCDTHWYPEDAHVLCRQLSCGAAVSTTGGKYIGERTG
RVWGHRFHCLGNESLLDNCQMTVLGAPPCIHGNTVSVICTGSLTGPLLPCVANLSDPYLS
AVPEGRAFICLEDKRLRLVNGDGRCAGRVEIYHNGMWGTICDDDWDLSDAHVVCRKLGCG
VALNATVSAHFGAGSGPIWLDDLNCIGTESHLWQCPSRGWGQHDCRHKEDAGVICSEFTA
LRLYSETEVESCAGRLEVFYNGTWGSVGRRNITTAIAGIVCKQLGCGENGVVSLAPLSKI
GSGFMWVDDIQCSKTHISIWQCLSAPWERRISSPAEETWITCEDRIRVRGGDTECSGRVE
IWHAGSWGTVCDDSWDLAEAEVVCQQLGCGSALAALKEASFGQGTGTIWLDEMQCKGNES
FLWDCHAKPWGQSDCGHKEDAGVRCSGQSLKSPNASSGHSALILSSIFGLLLLVLFILFL
TWCQVQKQKHLSLRDDTPSHGCEDARDTSLLEVLPASEATK
Download sequence
Identical sequences ENSMMUP00000029108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]