SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029122 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029122
Domain Number 1 Region: 7-120
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-26
Family ALDH-like 0.00089
Further Details:      
 
Domain Number 2 Region: 137-271
Classification Level Classification E-value
Superfamily ALDH-like 7.33e-16
Family ALDH-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029122   Gene: ENSMMUG00000022117   Transcript: ENSMMUT00000031113
Sequence length 281
Comment pep:known chromosome:MMUL_1:19:55721699:55724226:1 gene:ENSMMUG00000022117 transcript:ENSMMUT00000031113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFQAGDVPSEHPFYPPTLVSNLPPASPCARAEVPWPVVVASPFRTAKEALALANGTPRGG
SASVWSERLGQALELGYGLQVGTVWINAHGLRDPSVPTGGCKESGCSWHGGPDGLYEYLR
PSGTPAQLSCLSKNLNYDTFGLAVPSTLPAGTEIGPSPAPPYGLFVGGRFQAPGARSSRP
IQDSSGNLHGYVAEGGAKDIRGAVEAAHQAFPGWAGQSPGARAALLWALAAALERRKSTL
ASRLERQGVELKAAEAEVELSARRLRAWGARAQAQGHTLQV
Download sequence
Identical sequences ENSMMUP00000029122 9544.ENSMMUP00000029122 ENSMMUP00000029122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]