SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029130 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029130
Domain Number 1 Region: 269-326
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.1e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029130
Domain Number - Region: 229-274
Classification Level Classification E-value
Superfamily ARM repeat 0.00489
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029130   Gene: ENSMMUG00000022122   Transcript: ENSMMUT00000031121
Sequence length 326
Comment pep:known chromosome:MMUL_1:7:144370386:144411683:-1 gene:ENSMMUG00000022122 transcript:ENSMMUT00000031121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPAS
QQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAAN
GAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTG
NKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEED
YDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWK
FHLKDGIMNLNGRDYIFSKAIGDAEW
Download sequence
Identical sequences A0A2I2YC53
ENSMMUP00000029130 NP_001265869.1.87134 NP_001265869.1.92137 XP_011804857.1.43180 XP_011825094.1.47321 XP_014999749.1.72884 XP_018865730.1.27298 XP_018865731.1.27298 XP_018865732.1.27298 XP_018865733.1.27298 XP_018865734.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]