SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029173 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029173
Domain Number 1 Region: 44-300
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.88e-65
Family Carbonic anhydrase 0.00000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029173   Gene: ENSMMUG00000022161   Transcript: ENSMMUT00000031170
Sequence length 328
Comment pep:known chromosome:MMUL_1:19:54943155:54951687:-1 gene:ENSMMUG00000022161 transcript:ENSMMUT00000031170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAARLSAPRALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWS
LCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVS
GGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRSPNG
LAILSLFVNVAGSSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGS
LSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNGRPLQPLAHRALR
GNRDPRHPERRCRGPNYRLHVDGAPHGR
Download sequence
Identical sequences A0A0A0MXB8 A0A2K5NRP5 A0A2K6A900 A0A2K6E9Q8 A0A2K6KH04 A0A2K6RKG6 G7PY41 H9ER59
9544.ENSMMUP00000029173 ENSPANP00000014773 XP_005589849.1.63531 XP_010366947.1.97406 XP_011734477.1.29376 XP_011834755.1.47321 XP_011936149.1.92194 XP_014979959.1.72884 XP_017719816.1.44346 ENSMMUP00000029173 ENSMMUP00000029173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]