SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029330 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029330
Domain Number 1 Region: 613-726
Classification Level Classification E-value
Superfamily C-type lectin-like 9.89e-46
Family Noncollagenous (NC1) domain of collagen IV 0.000000433
Further Details:      
 
Domain Number 2 Region: 506-612
Classification Level Classification E-value
Superfamily C-type lectin-like 4e-43
Family Noncollagenous (NC1) domain of collagen IV 0.000000877
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029330   Gene: ENSMMUG00000022282   Transcript: ENSMMUT00000031345
Sequence length 727
Comment pep:known chromosome:MMUL_1:17:90559246:90588673:1 gene:ENSMMUG00000022282 transcript:ENSMMUT00000031345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDIKGEKGDEGPMGLKGYLGAKGIQGMPGIPGLSGIPGLPGRPGHIKGVKGDIGAPGIP
GLPGFPGVAGPPGITGFPGFIGSRGDKGAPGRAGLYGEIGPTGDFGDIGDTINLPGRPGL
KGEQGTAGIPGLKGFFGEKGTEGDIGFPGITGVTGVQGPPGLKGQTGFPGLTGPPGSQGE
PGRIGLPGGKGDDGWPGIPGLPGFPGLRGIRGLHGLPGTKGFPGSPGADIHGDPGFPGPP
GDRGDPGDANTLPGPVGVPGQKGEQGAPGERGPPGSPGLQGFPGITPPSNISGAPGDKGA
PGIFGLKGYRGPPGPPGSAALPGSKGDAGNPGAPGTPGTKGWAGDSGPQGRPGVFGLPGE
KGPRGEQGFMGNTGPAGAVGDRGPKGPKGDPGFPGAPGIVGAPGIAGIPQKIAIPPGTVG
PQGRRGPPGAPGEMGPQGPPGEPGFRGAPGKAGPQGRGGVSAVPGFRGDEGPVGHQGPIG
QEGAPGRPGSPGLPGMPGRSVSIGYLLVKHSQTEQEPMCPVGMNKLWSGYSLLYFEGQEK
AHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMPVAEDEIKP
YISRCSVCEAPAVAIAVHSQDVSIPHCPAGWRSLWIGYSFLMHTAAGDEGGGQSLVSPGS
CLEDFRATPFIECNGGRGTCHYYANKYSFWLTTIPEQSFQGSPSADTLKAGLIRTHISRC
QVCMKNL
Download sequence
Identical sequences ENSMMUP00000029330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]