SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029333 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029333
Domain Number 1 Region: 363-644
Classification Level Classification E-value
Superfamily Kelch motif 6.15e-45
Family Kelch motif 0.0032
Further Details:      
 
Domain Number 2 Region: 748-894
Classification Level Classification E-value
Superfamily C-type lectin-like 7e-24
Family C-type lectin domain 0.0031
Further Details:      
 
Domain Number 3 Region: 129-251
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-22
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 4 Region: 250-321,711-764
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000385
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 5 Region: 1028-1074
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000352
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029333
Domain Number - Region: 100-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00223
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029333   Gene: ENSMMUG00000022283   Transcript: ENSMMUT00000031348
Sequence length 1394
Comment pep:known_by_projection chromosome:MMUL_1:10:36799982:36976001:1 gene:ENSMMUG00000022283 transcript:ENSMMUT00000031348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAAAATEARLRRRTAATAALAGRSGWPHRDWDVTRAGRPGLGAGLRLPRLLSPPLRPR
LLLLLLLLSPPLLLLLLLPCEAEAAAAAAAVSGSAAAEAKECDRPCVNGGRCNPGTGQCV
CLAGWVGEQCQHCGGRFRLTGSSGFVTDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFAT
ECSWDHLYVYDGDSIYAPLVAAFSGLIVPERDGNETVPEVVATSGYALLHFFSDAAYNLT
GFNITYSFDMCPNNCSGRGECKISNNSNTVECECSENWKGEACDIPYCTDNCGSPRRGIC
NSSDVRGCSCFSGWQGPGCSVPVPANQSFWTREEYSNLKLPRASHKAVVNGNIMWVVGGY
MFNHSDYNMVLAYDLASREWLPLNRSVNNVVVRYGHSLALYKDKIYMYGGKIDSTGNVTN
ELRVFHIHNESWVLLTPKAKEQYAVVGHSSHIVTLKNGRVVMLVIFGHCPLYGYISNVQE
YDLDKNTWSILHTQGALVQGGYGHSSVYDHRTRALYVHGGYKAFSANKYRLADDLYRYHV
DTQMWTILKDSRFFRYLHTAVIVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDR
WSVLPRPDLHHDVNRFGHSAVLHNSTMYVFGGFNSLLLSDILVFTSEQCDGHRSEAACLA
AGPGIRCLLTMTDVTSTRIVTAAQPTPMTATGAMTIVSPGTTAARKARYENCPKDNPMYY
CNKKTSCRSCALDQNCQWEPRNQECIALPENICGIGWHLVGNSCLKITTAKENYDNAKLF
CRNHNAVLASLTTQKKVEFVLKQLRIMQSSQSMSKLTLTPWVGLRKINVSYWCWEDMSPF
TNSLLQWMPSEPSDAGFCGILSEPSTRGLKAATCINPLNGSVCERPANHSAKQCRTPCAL
RTACGECTSGSSECMWCSNMKQCVDSNAYVASFPFGQCMEWYTMSTCPPENCSGYCTCSH
CLEQPGCGWCTDPSNTGKGKCIEGSYKGPVKMPSQAPTGNFYPQPLLNSSMCLEDSRYNW
SFIHCPACQCNGHSKCINQSICEKCENLTTGKHCETCISGFYGDPTNGGKCQPCKCNGHA
SLCNTNTGKCFCTTKGVKGDECQLCEVENRYQGNPLKGTCYYTLLIDYQFTFSLSQEDDR
YYTAINFVATPDEQNRDLDMFINASKNFNLNITWAASFSAGTQAGEEMPVVSKTNIKEYK
DSFSNEKFDFRNHPNITFFVYVSNFTWPIKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLL
VAAVVWKIKQSCWASRRREQLLREMQQMASRPFASVNVALETDEEPPDLIGGSIKTVPKP
IALEPCFGNKAAVLSVFVRLPRGLGGIPPPGQSGLAVASALVDISQQMPIVYKEKSGAVR
NRKQQPPAQPGTCI
Download sequence
Identical sequences 9544.ENSMMUP00000029333 ENSMMUP00000029333 ENSMMUP00000029333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]