SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029334 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029334
Domain Number 1 Region: 297-578
Classification Level Classification E-value
Superfamily Kelch motif 5.1e-45
Family Kelch motif 0.0032
Further Details:      
 
Domain Number 2 Region: 718-864
Classification Level Classification E-value
Superfamily C-type lectin-like 5.77e-24
Family C-type lectin domain 0.0031
Further Details:      
 
Domain Number 3 Region: 63-185
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-22
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 4 Region: 998-1044
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000297
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029334
Domain Number - Region: 32-66
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000778
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 182-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00519
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029334   Gene: ENSMMUG00000022283   Transcript: ENSMMUT00000031349
Sequence length 1207
Comment pep:known_by_projection chromosome:MMUL_1:10:36799982:36925095:1 gene:ENSMMUG00000022283 transcript:ENSMMUT00000031349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAAAATEARLRRRTAATAALAGRSGWPHRDWDECDRPCVNGGRCNPGTGQCVCLAGWV
GEQCQHCGGRFRLTGSSGFVTDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFATECSWDH
LYVYDGDSIYAPLVAAFSGLIVPERDGNETVPEVVATSGYALLHFFSDAAYNLTGFNITY
SFDMCPNNCSGRGECKISNNSNTVECECSENWKGEACDIPYCTDNCGSPRRGICNSSDVR
GCSCFSGWQGPGCSVPVPANQSFWTREEYSNLKLPRASHKAVVNGNIMWVVGGYMFNHSD
YNMVLAYDLASREWLPLNRSVNNVVVRYGHSLALYKDKIYMYGGKIDSTGNVTNELRVFH
IHNESWVLLTPKAKEQYAVVGHSSHIVTLKNGRVVMLVIFGHCPLYGYISNVQEYDLDKN
TWSILHTQGALVQGGYGHSSVYDHRTRALYVHGGYKAFSANKYRLADDLYRYHVDTQMWT
ILKDSRFFRYLHTAVIVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRWSVLPR
PDLHHDVNRFGHSAVLHNSTMYVFGGFNSLLLSDILVFTSEQCDGHRSEAACLAAGPGIR
CVWDTGSSQCISWALATDEQEEKLKSECFSKRTFDHDRCDQHTDCYSCTANTNDCHWCND
HCVPRNHSCTEGQISIFRYENCPKDNPMYYCNKKTSCRSCALDQNCQWEPRNQECIALPE
NICGIGWHLVGNSCLKITTAKENYDNAKLFCRNHNAVLASLTTQKKVEFVLKQLRIMQSS
QSMSKLTLTPWVGLRKINVSYWCWEDMSPFTNSLLQWMPSEPSDAGFCGILSEPSTRGLK
AATCINPLNGSVCERPANHSAKQCRTPCALRTACGECTSGSSECMWCSNMKQCVDSNAYV
ASFPFGQCMEWYTMSTCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGSYKGPV
KMPSQAPTGNFYPQPLLNSSMCLEDSRYNWSFIHCPACQCNGHSKCINQSICEKCENLTT
GKHCETCISGFYGDPTNGGKCQPCKCNGHASLCNTNTGKCFCTTKGVKGDECQLCEVENR
YQGNPLKGTCYYTLLIDYQFTFSLSQEDDRYYTAINFVATPDEQNRDLDMFINASKNFNL
NITWAASFSAGTQAGEEMPVVSKTNIKEYKDSFSNEKFDFRNHPNITFFVYVSNFTWPIK
IQVRRAF
Download sequence
Identical sequences ENSMMUP00000029334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]