SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029342 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029342
Domain Number 1 Region: 1-177
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-64
Family Protein kinases, catalytic subunit 0.0000507
Further Details:      
 
Domain Number 2 Region: 536-644
Classification Level Classification E-value
Superfamily KA1-like 4.41e-47
Family Kinase associated domain 1, KA1 0.00000544
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029342
Domain Number - Region: 187-235
Classification Level Classification E-value
Superfamily UBA-like 0.00188
Family UBA domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029342   Gene: ENSMMUG00000022288   Transcript: ENSMMUT00000031359
Sequence length 644
Comment pep:known_by_projection chromosome:MMUL_1:1:149671757:149735175:-1 gene:ENSMMUG00000022288 transcript:ENSMMUT00000031359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKCIVHRDLKAENLLLDGDMN
IKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSL
PFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPIKRGSLEQIMKDRWMNVGH
EEEELKPYTEPDPDFNDTKRIDIMVTMGFARDEINDALINQKYDEVMATYILLGRKPPEF
EGGESSSGNLCQRSRPSSDLNNSTLQSPAHLKVQRSISANQKQRRFSDHAGPSIPPAVSY
TKRAQANSVESEQKEEWDKDVARKLGSTTVGSKSEMTASPLVGPERKKSSTIPSNNVYSG
GSMARRNTYVCERTTDRYTALQNGKDSSLTEMSVSSISSAGSSVASAVPSARPRHQKSMS
TSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSRSTFHG
EQLRERRSAAYNGPPASPSHETGAFAHARRGTSTGIISKITSKFVRRSTSGEPKERDKEE
GKDSKPRSLRFTWSMKTTSSMDPNDMMREIRKVLDANNCDYEQKERFLLFCVHGDARQDS
LVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL
Download sequence
Identical sequences ENSMMUP00000029342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]