SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029417 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029417
Domain Number 1 Region: 416-529,649-786
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.54e-68
Family Phosphate binding protein-like 0.000000149
Further Details:      
 
Domain Number 2 Region: 20-394
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.39e-43
Family L-arabinose binding protein-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029417   Gene: ENSMMUG00000022347   Transcript: ENSMMUT00000031439
Sequence length 956
Comment pep:known chromosome:MMUL_1:14:119071113:119399992:1 gene:ENSMMUG00000022347 transcript:ENSMMUT00000031439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRVSAPLVLLPAWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFVKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAY
YTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVAEGLSMDSRLYASNISDTLFNTTLVV
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVS
VCQEMVTELRSIILCQDSIHPRRRRAGVPPPRPPIPEERRPRGTATLSNGKLCGAGEPDQ
LAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE
Download sequence
Identical sequences A0A2K5MDE5 A0A2K5U1S8 A0A2K5XS39 A0A2K6BYI5 U3D983
ENSMMUP00000029417 ENSMMUP00000029417 9544.ENSMMUP00000029417 XP_002799927.1.72884 XP_005580009.1.63531 XP_011730490.1.29376 XP_011820367.1.47321 XP_011908528.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]