SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029449 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000029449
Domain Number - Region: 181-211
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0732
Family RILP dimerisation region 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029449   Gene: ENSMMUG00000022376   Transcript: ENSMMUT00000031472
Sequence length 277
Comment pep:known chromosome:MMUL_1:9:80982350:80986356:1 gene:ENSMMUG00000022376 transcript:ENSMMUT00000031472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKDKLLCSQLQVV
DFLQNILAQEDTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQ
MEEAQRKRTQLQEAFEQLQAKKQVAMEKRRAAQNQWQLQQEKHLQHLAKVSAEVRERKTG
TQQELEGVFQKLGNLKQQAEQEQDKLQRYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKP
QQLTRPQEQSTGDTMGRDAGVSFKAVSLQPAGDANLP
Download sequence
Identical sequences A0A096P584 A0A2K5P273 A0A2K6CQF6 G7N2F8 G7PDF8
ENSMMUP00000029449 9544.ENSMMUP00000029449 XP_001098136.3.72884 XP_005565881.1.63531 XP_005565882.1.63531 XP_011765477.1.29376 XP_011765478.1.29376 XP_011906169.1.92194 XP_015003080.1.72884 ENSMMUP00000029449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]