SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029549 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029549
Domain Number 1 Region: 74-247
Classification Level Classification E-value
Superfamily C-type lectin-like 7e-52
Family C-type lectin domain 0.0000000604
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029549
Domain Number - Region: 31-92
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0017
Family Occludin/ELL domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029549   Gene: ENSMMUG00000022463   Transcript: ENSMMUT00000031584
Sequence length 268
Comment pep:known chromosome:MMUL_1:19:7702990:7707404:-1 gene:ENSMMUG00000022463 transcript:ENSMMUT00000031584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSKEPRLQQLGLLVSKVPSSLSQGQSKQDAIYQNLTQLKAAVGELPEKSKQQEIYEEL
TRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKQQEIYQELSRLKAAVERLCRPC
PWEWTFFQGNCYFMSNSQRNWHNSITACQEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWM
GLSDLNHEGTWQWVDGSPLLPSFKQYWNKGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWI
CKKSAASCSGDEERLLSPAPTTPNPPPE
Download sequence
Identical sequences ENSMMUP00000029549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]