SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029556 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029556
Domain Number 1 Region: 248-385
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-47
Family C-type lectin domain 0.000000155
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029556
Domain Number - Region: 142-204
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.000275
Family Occludin/ELL domain 0.0054
Further Details:      
 
Domain Number - Region: 75-136
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0111
Family Occludin/ELL domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029556   Gene: ENSMMUG00000022463   Transcript: ENSMMUT00000031592
Sequence length 406
Comment pep:known chromosome:MMUL_1:19:7702981:7707415:-1 gene:ENSMMUG00000022463 transcript:ENSMMUT00000031592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSKEPRLQQLGLLEEEQLGGVGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQV
SKVPSSLSQGQSKQDAIYQNLTQLKVAVSELSEKSKQQEIYQELTRLKAAVGELPEKSKQ
QEIYEELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKQQEIYQELSRLKAAV
GDLPEKSKQQEIYQKLTQLKAAVDGLPDRSKQQEIYQELIQLKAAVDLEGWTDTGIWTTS
SEPSPDRPPPTERLCRPCPWEWTFFQGNCYFMSNSQRNWHNSITACQEVGAQLVVIKSAE
EQNFLQLQSSRSNRFTWMGLSDLNHEGTWQWVDGSPLLPSFKQYWNKGEPNNVGEEDCAE
FSGNGWNDDKCNLAKFWICKKSAASCSGDEERLLSPAPTTPNPPPE
Download sequence
Identical sequences ENSMMUP00000029556 9544.ENSMMUP00000029556 ENSMMUP00000029549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]