SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029561 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029561
Domain Number 1 Region: 74-148
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-26
Family C-type lectin domain 0.00000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029561   Gene: ENSMMUG00000022463   Transcript: ENSMMUT00000031598
Sequence length 169
Comment pep:known chromosome:MMUL_1:19:7702990:7707404:-1 gene:ENSMMUG00000022463 transcript:ENSMMUT00000031598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSKEPRLQQLGLLEEEQLGGVGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQV
SKVPSSLRSRESSRSNRFTWMGLSDLNHEGTWQWVDGSPLLPSFKQYWNKGEPNNVGEED
CAEFSGNGWNDDKCNLAKFWICKKSAASCSGDEERLLSPAPTTPNPPPE
Download sequence
Identical sequences ENSMMUP00000029561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]