SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029571 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029571
Domain Number 1 Region: 379-665
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-83
Family Protein kinases, catalytic subunit 0.0000000000465
Further Details:      
 
Domain Number 2 Region: 166-269
Classification Level Classification E-value
Superfamily Immunoglobulin 3.95e-23
Family I set domains 0.00000271
Further Details:      
 
Domain Number 3 Region: 74-160
Classification Level Classification E-value
Superfamily Immunoglobulin 5.59e-20
Family I set domains 0.00000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029571   Gene: ENSMMUG00000022478   Transcript: ENSMMUT00000031610
Sequence length 733
Comment pep:known_by_projection chromosome:MMUL_1:8:38871512:38929093:-1 gene:ENSMMUG00000022478 transcript:ENSMMUT00000031610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSWKCLLFWAVLVTATLCTARPSPTLPEQDALPSSEDDDDDDDSSSEEKETDNTKPNRM
PVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVR
YATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVAL
GSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLR
NVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISC
MVGSVIVYKMKSGTKKSDFHSQMAVHKLAKSIPLRRQTRVSADSSASMNSGVLLVRPSRL
SSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVT
KVAVKMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNL
REYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNV
LVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVL
LWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQ
LVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPR
HPAQLANGGLKRR
Download sequence
Identical sequences 9544.ENSMMUP00000029571 ENSMMUP00000029571 ENSMMUP00000029572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]