SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029633 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029633
Domain Number 1 Region: 36-499
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.15e-113
Family L-arabinose binding protein-like 0.00000000667
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029633
Domain Number - Region: 506-549
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0683
Family TNF receptor-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029633   Gene: ENSMMUG00000022513   Transcript: ENSMMUT00000031674
Sequence length 879
Comment pep:known chromosome:MMUL_1:3:130400561:130623515:-1 gene:ENSMMUG00000022513 transcript:ENSMMUT00000031674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRI
NEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
DEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSD
KSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNIC
IATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVAS
DGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQ
CSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCD
AMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNVGGKYSY
LKVGHWAETLSLDVNSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCESYEYL
ADEFTCMDCGPGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTCMVITVFIK
HNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAICYSALL
TKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTRRYTLA
EKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCI
IWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLH
LNRFSVSGTGTTYSQSSASMYVPTVCNGREVLDSTTSSL
Download sequence
Identical sequences A0A096NQX7 A0A2K5I3C7 A0A2K5MFQ8 A0A2K6JMK9 F6YNZ0 G7P1W4
ENSMMUP00000029633 9544.ENSMMUP00000029633 XP_001107588.1.72884 XP_005550406.1.63531 XP_005550407.1.63531 XP_011783066.1.43180 XP_011936768.1.92194 XP_014989652.1.72884 XP_015303319.1.63531 XP_017707309.1.44346 ENSMMUP00000029633 ENSPANP00000015441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]