SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029702 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029702
Domain Number 1 Region: 394-550
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.09e-29
Family Toll/Interleukin receptor TIR domain 0.00049
Further Details:      
 
Domain Number 2 Region: 32-139
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000148
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 242-347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000187
Family I set domains 0.054
Further Details:      
 
Domain Number 4 Region: 155-267
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000499
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029702   Gene: ENSMMUG00000022562   Transcript: ENSMMUT00000031747
Sequence length 570
Comment pep:known chromosome:MMUL_1:2:182836885:182972361:1 gene:ENSMMUG00000022562 transcript:ENSMMUT00000031747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYST
AHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTT
YCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMG
CYKIQNFNNVIPEGMNLSFLIAFISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNA
VPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDIPIDVTINE
SISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAATVKQKVPAPRYTVEL
ACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF
VLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQAL
LELKAGLENMASQGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWK
QLQVAMPVKKSPRRSSSDEQGLSYSSLKNV
Download sequence
Identical sequences A0A2K5N7Y7 A0A2K5X5J5 A0A2K5Y2C5 A0A2K6CTC4 P59822
NP_001028132.1.72884 XP_005545466.1.63531 XP_011721428.1.29376 XP_011836740.1.47321 XP_011836741.1.47321 XP_011836742.1.47321 XP_011892218.1.92194 XP_015300414.1.63531 9544.ENSMMUP00000029702 ENSMMUP00000029702 ENSMMUP00000029702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]