SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029894 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029894
Domain Number 1 Region: 106-322
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.42e-62
Family BC ATP-binding domain-like 0.00000205
Further Details:      
 
Domain Number 2 Region: 604-773
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 4.88e-58
Family PurM C-terminal domain-like 0.0000134
Further Details:      
 
Domain Number 3 Region: 809-1005
Classification Level Classification E-value
Superfamily Formyltransferase 6.15e-53
Family Formyltransferase 0.0000000176
Further Details:      
 
Domain Number 4 Region: 435-597
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 2.84e-48
Family PurM N-terminal domain-like 0.00000235
Further Details:      
 
Domain Number 5 Region: 3-105
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.75e-34
Family BC N-terminal domain-like 0.0000389
Further Details:      
 
Domain Number 6 Region: 332-426
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 2.04e-30
Family BC C-terminal domain-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029894   Gene: ENSMMUG00000022702   Transcript: ENSMMUT00000031950
Sequence length 1009
Comment pep:known_by_projection chromosome:MMUL_1:3:13020891:13055004:1 gene:ENSMMUG00000022702 transcript:ENSMMUT00000031950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARVLIIGSGGREHTLAWKLAQSHHVKQVLVAPGNAGTACSEKISNNAISTSDHTALAQ
FCKEEKIEFVVVGPEAPLAAGIVGNLTSAGVRCFGPTAEAAQLESSKRFAKEFMDRHGIP
TAQWKAFTKPEEACSFIMSADFPALVVKASGLAAGKGVIVAKSKEEACKAVQEIMQEKAF
GAAGETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYCPAP
QVSNDLLLKIKDTVLQRTVDGMQQEGTPYTGILYAGIMLTKDGPKVLEFNCRFGDPECQV
ILPLLKSDLYEVIQSTLNGLLCTSLPVWLENHTALTVVMASKGYPGDYTKGVEITGFSEA
QALGLEVFHAGTALKNGKVVTHGGRVLAVTAIRENLVSALEEAKKGLAAIKFEGAIYRKD
IGFRAIAFLQQPRGLTYKESGVDIAAGNTLVKKIQPLAEATSRSGCKVDLGGFAGLFDLK
AAGFKDPLLASGTDGVGTKLKIAQLCNKHDTIGQDLVAMCVNDILAQGAEPLFFLDYFSC
GKLDLSVTEAVVAGIAKACGKAGCALLGGETAEMPDMYPPGEYDLAGFAVGAMERDQKLP
HLERITEGDVVVGIASSGLHSNGFSLVRKIVAKSFLQYSSPAPDGCGDQTLGDLLLTPTR
IYSHSLLPILRSGHVKAFAHITGGGLLENIPRVLPEKLGVDLDAQTWRIPKVFSWLQQEG
QLSEEEMARTFNCGVGAALVVSKEQTEQILRDIQQHKEEAWVIGSVVARAEGSPCVKVKN
LIESMQINGSVLKNGSLKNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDVV
ISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDNAIDLVLEEFSIDITLCKNLLLLFN
SMCQQQAGKMLNIHPSLLPCFKGSNAHEQALETGVTVTGCTVHFVAEEVDAGQIILQEAV
PVKRGDTVATLSERVKLAEHKTFPAALQLVASGTVQLGENGKICWVKEE
Download sequence
Identical sequences 9544.ENSMMUP00000029894 ENSMMUP00000029894 ENSMMUP00000029894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]