SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029962 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029962
Domain Number 1 Region: 101-335
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.16e-60
Family RecA protein-like (ATPase-domain) 0.000000000896
Further Details:      
 
Domain Number 2 Region: 17-85
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 2.99e-18
Family DNA repair protein Rad51, N-terminal domain 0.0000694
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029962   Gene: ENSMMUG00000004579   Transcript: ENSMMUT00000032023
Sequence length 339
Comment pep:known chromosome:MMUL_1:7:19063244:19101163:1 gene:ENSMMUG00000004579 transcript:ENSMMUT00000032023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
Download sequence
Identical sequences A0A096NTH7 A0A0D9R5C5 A0A1D5QVN1 A0A2I3H1V5 A0A2I3SZ08 A0A2K5VNC1 A0A2K6NAH8 H2NMV0 Q06609
ENSNLEP00000003845 ENSPTRP00000011825 ENSPTRP00000011825 9600.ENSPPYP00000007198 9606.ENSP00000267868 ENSMMUP00000029962 ENSP00000267868 ENSP00000267868 ENSPANP00000016348 ENSNLEP00000003845 ENSPPYP00000007198 gi|19924133|ref|NP_002866.2| 5jzc_A 5jzc_B 5jzc_C 5jzc_D 5jzc_E 5jzc_F 5jzc_G 5np7_A 5np7_B 5np7_C 5np7_D 5np7_E 5np7_F 5np7_G 5nwl_A 5nwl_B 5nwl_C 5nwl_D 5nwl_E 5nwl_F 5nwl_G 5nwl_H 5nwl_I 5nwl_J 5nwl_K 5nwl_L 5nwl_M 5nwl_N ENSPPYP00000007198 NP_002866.2.87134 NP_002866.2.92137 XP_001144621.1.37143 XP_002825350.1.23681 XP_003266786.1.23891 XP_003826633.1.60992 XP_005559254.1.63531 XP_006720689.1.92137 XP_008015187.1.81039 XP_008015188.1.81039 XP_010386841.1.97406 XP_011520159.1.92137 XP_011520160.1.92137 XP_011520161.1.92137 XP_011520162.1.92137 XP_014997429.1.72884 XP_014997430.1.72884 XP_014997431.1.72884 XP_016783439.1.37143 trt001000151.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]