SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029966 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029966
Domain Number 1 Region: 1191-1310
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.96e-20
Family Pentraxin (pentaxin) 0.019
Further Details:      
 
Domain Number 2 Region: 204-271
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1061-1186
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000471
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 143-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000236
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 754-897
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000104
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 962-1002
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000261
Family EGF-type module 0.015
Further Details:      
 
Domain Number 7 Region: 997-1040
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000494
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 8 Region: 263-320
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000208
Family Complement control module/SCR domain 0.0047
Further Details:      
 
Domain Number 9 Region: 44-200
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000942
Family Growth factor receptor domain 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029966
Domain Number - Region: 494-556
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00043
Family Complement control module/SCR domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029966   Gene: ENSMMUG00000022759   Transcript: ENSMMUT00000032028
Sequence length 1316
Comment pep:known chromosome:MMUL_1:15:25635970:25746262:1 gene:ENSMMUG00000022759 transcript:ENSMMUT00000032028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAPKEEHCYLLHSFEEFEALARRALHEDLPSGSFIQDDMVHCSYLCDEGKDCCDRMAS
CKCGTHTGHFECICEKGYYGKGLQYECTACPSGTYKPEGSPGGISSCIPCPDENHTSPPG
STSPEDCVCKEGYRASGQTCELVHCPALKPPENGYFIQNTCNNHFNAACGVRCHPGFDLV
GSSIILCLPNGLWSGSESYCRVRTCPHLRQPKHGHISCSTREMLYKTTCFIACDEGYRLE
GNDKLTCQGNSHWDGPEPRCVERHCSTFQTPKDVIISPHNCGKQPAKFGTICYVSCRQGF
ILSGIKEMLRCTTSGKWNVGVQTAVCKDVEAPQITCPKDIEAKTLEQQDSANVTWQIPTA
KDNSGEKVSIHVHPAFTPPYLFPIGDVAIVYTATDLSGNQASCVFHIKVIDVEPPVIDWC
RSPPPIQVSEKVYAASWDEPQFSDNSGAELVITRSHTQGDLFPQGETIVQYTATDPSGNN
RTCDIHIVIKGSPCEIPFTPINGDFICAQDSTGVNCTLTCLEGYDFTEGSTDKYYCAYED
GVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLGKMVPSF
CSDAEDIDCRLEENLTKKYCLEYNYDYENGFAIGPGGWGAANRLDYSYDDFLDTMQETPT
SIGNARSSRIKRSAPLSDYKIKLIFNITASVPLPDERNDTLEWENQQRLLQTLETITNKL
KRTLSKDPMYSFQLASEILIADSNSLETKKASPFCRPGSVLRGRMCVNCPLGTYYSLEHF
TCESCRIGSYQDEEGQLECKPCPSGMYTEYIHSRNISDCKAQCKQGTYSYSGLETCESCP
LGTYQPKFGSRSCLSCPENTSTVKRGAVNISSCGVPCPEGKFSRSGLMPCHPCPRDYYQP
DAGKAFCLACPFYGTTPFAGSRSITECSSFSSTFSAAEESVVPPASLGHIKKRHEISSQV
FHECFLNPCHNSGTCQQLGRGYVCLCPLGYTGLKCETDIDECSPLPCLNNGVCKDLVGEF
ICECPSGYTGLRCEENINECSSSPCLNKGICVDGVAGYRCTCVKGYVGLHCETEVNECQS
NPCLNNAVCEDQVGGFLCKCPPGFLGTRCGKNVDECLSRPCKNGATCKDGANSFRCLCAA
GFTGSHCELNINECQSNPCRNQATCVDELNSYSCKCQPGFSGNRCETEQSIGFNLDFEVS
GIYGYVMLDGVLPSLHALTCTFWMKSSDDMNYGTPISYAVDNGSDNTLLLTDYNGWVLYV
NGKEKITNCPSVNDGRWHHIAITWTSANGVWKVYIDGKLSDGGAGLSVGLPIPGMF
Download sequence
Identical sequences ENSMMUP00000029966 ENSMMUP00000039665 9544.ENSMMUP00000029966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]