SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030057 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030057
Domain Number 1 Region: 21-117
Classification Level Classification E-value
Superfamily Immunoglobulin 1.87e-36
Family V set domains (antibody variable domain-like) 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030057   Gene: ENSMMUG00000030652   Transcript: ENSMMUT00000032127
Sequence length 147
Comment pep:novel chromosome:MMUL_1:13:113139001:113139551:1 gene:ENSMMUG00000030652 transcript:ENSMMUT00000032127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APGAPVALAPRFPNSGARCDIQMTQSPSSLSASVGDTVTITCRASQGINKELDWYQQKPG
KAPTLLIYAASSLQTGVSSRFSGSGSGTDFTLTISSLQPEDVATYYCQQDYNTPSTVLQA
ITKTPREADNVSPHCPSYSSWCLHLLR
Download sequence
Identical sequences 9544.ENSMMUP00000030057 ENSMMUP00000030057 ENSMMUP00000030057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]