SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030436 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030436
Domain Number 1 Region: 66-166
Classification Level Classification E-value
Superfamily L domain-like 3.06e-16
Family Ngr ectodomain-like 0.00042
Further Details:      
 
Domain Number 2 Region: 203-290
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000101
Family I set domains 0.039
Further Details:      
 
Domain Number 3 Region: 283-383
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000151
Family I set domains 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030436   Gene: ENSMMUG00000023117   Transcript: ENSMMUT00000032527
Sequence length 537
Comment pep:known chromosome:MMUL_1:15:93405332:93619329:1 gene:ENSMMUG00000023117 transcript:ENSMMUT00000032527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSWIRWHGPAMARLWGFCWLVVGFWRAALACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASP
LHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTWPRGSPKTA
Download sequence
Identical sequences XP_005582107.1.63531 XP_010376383.1.97406 XP_011769382.1.29376 XP_014973473.1.72884 XP_017715412.1.44346 ENSMMUP00000030436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]