SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030437 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030437
Domain Number 1 Region: 533-821
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.83e-85
Family Protein kinases, catalytic subunit 0.000000137
Further Details:      
 
Domain Number 2 Region: 66-166
Classification Level Classification E-value
Superfamily L domain-like 6.05e-16
Family Ngr ectodomain-like 0.00042
Further Details:      
 
Domain Number 3 Region: 203-290
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000199
Family I set domains 0.039
Further Details:      
 
Domain Number 4 Region: 283-383
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000303
Family I set domains 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030437   Gene: ENSMMUG00000023117   Transcript: ENSMMUT00000032528
Sequence length 838
Comment pep:known chromosome:MMUL_1:15:93404357:93767385:1 gene:ENSMMUG00000023117 transcript:ENSMMUT00000032528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSWIRWHGPAMARLWGFCWLVVGFWRAALACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKDFSWFGFGKVKSRQG
VGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQL
KPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKD
FHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNP
PTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYST
DYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIE
CITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Download sequence
Identical sequences A0A2I3MH64 A0A2K5HWX5 A0A2K5VS28 A0A2K6BIB6 A0A2K6MNQ9 A0A2K6QVF4 F7DGW1
9544.ENSMMUP00000030437 ENSMMUP00000030437 ENSMMUP00000030437 NP_001248226.1.72884 XP_005582102.1.63531 XP_005582103.1.63531 XP_010376379.1.97406 XP_011769375.1.29376 XP_011769376.1.29376 XP_011769377.1.29376 XP_011769378.1.29376 XP_011769379.1.29376 XP_011801285.1.43180 XP_011801286.1.43180 XP_014973469.1.72884 XP_015292821.1.63531 XP_015292822.1.63531 XP_015292823.1.63531 XP_017715405.1.44346 XP_017715406.1.44346 XP_017715407.1.44346 XP_017715408.1.44346 XP_017715409.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]