SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030438 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030438
Domain Number 1 Region: 517-805
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.56e-85
Family Protein kinases, catalytic subunit 0.000000137
Further Details:      
 
Domain Number 2 Region: 66-166
Classification Level Classification E-value
Superfamily L domain-like 6.05e-16
Family Ngr ectodomain-like 0.00042
Further Details:      
 
Domain Number 3 Region: 203-290
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000185
Family I set domains 0.039
Further Details:      
 
Domain Number 4 Region: 283-383
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000278
Family I set domains 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030438   Gene: ENSMMUG00000023117   Transcript: ENSMMUT00000032529
Sequence length 822
Comment pep:known chromosome:MMUL_1:15:93404357:93766321:1 gene:ENSMMUG00000023117 transcript:ENSMMUT00000032529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSWIRWHGPAMARLWGFCWLVVGFWRAALACPTSCKCSASRIWCSDPSPGIVAFPRLEP
NSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHI
NFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNES
SKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVPNMYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASP
LHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVL
KRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHI
VKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQI
AAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWM
PPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQ
EVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Download sequence
Identical sequences A0A096P1W3 A0A2K5HX06 A0A2K5VS06 A0A2K6BIB8 A0A2K6MNS6 A0A2K6QVE0
XP_005582104.1.63531 XP_011769380.1.29376 XP_014973470.1.72884 XP_017715410.1.44346 ENSPANP00000019338 ENSMMUP00000030438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]