SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030524 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030524
Domain Number 1 Region: 6-402
Classification Level Classification E-value
Superfamily ALDH-like 6.41e-117
Family ALDH-like 0.00000000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030524   Gene: ENSMMUG00000023188   Transcript: ENSMMUT00000032620
Sequence length 431
Comment pep:known chromosome:MMUL_1:14:6693132:6705696:-1 gene:ENSMMUG00000023188 transcript:ENSMMUT00000032620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFEDTLRRLREAFHMGRTRSAEFRAAQLRGLGRFLHENKQLLHHALAQDLHKATQLDS
AFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAGNCVVLKPSEISKSMEKVLAEVLPRY
LDESCFAVVLGGPQETGQLLEHRFDYIFFTGSPRVGKIVMTAAAKHLTPVTLELGGKNPC
YVDDNCDPQTVANRVAWFRYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQ
SSPNLGRIINQKQFQRLRALLGCGHVAIGGQSDESDRYIAPTVLVDVQETEPVMQEEIFG
PILPIVNVRSVDEAIEFINRREKPLALYAFSNSSQVVKRVLTQTSSGGFCGNDGFMHMTL
ASLPFGGVGASGMGQYHGKFSFDTFSHHRACLLRRPGMEKLNALRYPPHSPRRLRVLLVA
MEARGCSCTLL
Download sequence
Identical sequences F7EIS9
ENSMMUP00000030524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]