SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030598 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030598
Domain Number 1 Region: 356-456
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00088
Further Details:      
 
Domain Number 2 Region: 94-155
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 9.29e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 
Domain Number 3 Region: 177-231,259-273
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000182
Family BphP N-terminal domain-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030598   Gene: ENSMMUG00000023249   Transcript: ENSMMUT00000032700
Sequence length 622
Comment pep:known chromosome:MMUL_1:11:27630634:27700065:1 gene:ENSMMUG00000023249 transcript:ENSMMUT00000032700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEEEAAEGGKVLREENQRIAPVVSSRVSPRTGPTAMGSFSSHMTEFPRKRKASDSDPS
QSGIMTEKVVEKISENPLTYLLSTRIEISASSGSREAHSQTEKRRRDKMNNLIEELSAMI
PQCNPMARKLDKLTVLRMAVQHLRSLKGMTNSYVGNNCRPSFIQDNELRHLILKTAEGFL
FVVGCERGKILFVSKSVSKILNYDQASLTGQSLFDFLHPKDVAKVKEQLSSFDISPREKL
IDAKTGLQVHSNFHTGRTHVYSGSRRSFFCRIKSCKISVKEEHECLPNPKKKEHRKFYTI
HCTGYLRSWPPNIVGMEEERNSKKDNSNFTCLVAIGRLQPYIIPQNSGEIHVKPTEFITR
FAMNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHSNLTDKHKAVLQSKEKILTDS
YKFRAKDGSFVTLKSQWFSFTNPWTKELEYIVSVNTLVLGHSEPGEASFFPCSSQSSEES
SRQSCMSVPGMSAGTVLGAGSIGTDIANEILDLQRLQSSSYLDDLSPTNLMKDTNTVNCR
SMSNKELFPPSPSEMGELEATRQNQSTVAVHSHEPLLSDGAQLDFDTLCDNDDTAMAAFM
NYLEAEGGLGDPGDFSDIQWTL
Download sequence
Identical sequences ENSMMUP00000030598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]